PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 233aa    MW: 26766 Da    PI: 7.2187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0969genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.7e-092470347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      WT  Ed+ + ++  +++ g   +W++Ia+ ++ g+++k++  +++++
      Gh_A09G0969 24 HWTRVEDKVFEQCLVLFPEGisdRWEKIAEQIP-GKSAKEVEQHFHML 70
                     6********************************.***********976 PP

2Myb_DNA-binding46.68.1e-15123167347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
      Gh_A09G0969 123 PWTEEEHKLFLIGLQKFGKGDWRSISRNVVVTRTPTQVASHAQKY 167
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.1E-62173IPR001005SANT/Myb domain
SuperFamilySSF466891.38E-102477IPR009057Homeodomain-like
PfamPF002493.5E-82470IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-52468IPR009057Homeodomain-like
PROSITE profilePS500906.5042571IPR017877Myb-like domain
CDDcd001677.43E-82571No hitNo description
PROSITE profilePS5129420.829116172IPR017930Myb domain
SuperFamilySSF466896.9E-17118172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17119171IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-11120166IPR009057Homeodomain-like
SMARTSM007174.7E-11120170IPR001005SANT/Myb domain
CDDcd001671.45E-9123168No hitNo description
PfamPF002499.1E-13123167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MYQDNNHYNG DPLFIESVAA ATTHWTRVED KVFEQCLVLF PEGISDRWEK IAEQIPGKSA  60
KEVEQHFHML VYDVYEIDAG RVQVPQYADD SVMLSQSWDS HNQISFVSKS KHHGDGERKK  120
GTPWTEEEHK LFLIGLQKFG KGDWRSISRN VVVTRTPTQV ASHAQKYFLR QSAVKKERKR  180
SSIHDITTVD SKTMDVPVEQ NRGSEPHGMV QQATQLQQLP HTGHFVGKYG YPM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.68500.0leaf| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485202.11e-170PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H75e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0NFJ51e-174A0A0B0NFJ5_G
STRINGGLYMA20G24600.17e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-82MYB family protein